PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020666.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 341aa    MW: 37375.3 Da    PI: 4.9794
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020666.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-142673148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++    G g+W+ +ar  g+ R++k+c++rw +yl
      Pbr020666.1 26 KGLWSPEEDDKLMRYMINNGQGCWSDVARNAGLQRCGKSCRLRWINYL 73
                     678*******************************************97 PP

2Myb_DNA-binding51.62.1e-1679122146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++++E+el+++++ +lG++ W+ Ia+ ++ gRt++++k++w++
      Pbr020666.1  79 RGAFSPQEEELIIHLHSLLGNR-WSQIAAQLP-GRTDNEIKNFWNS 122
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.9E-232076IPR009057Homeodomain-like
PROSITE profilePS5129416.7062173IPR017930Myb domain
SuperFamilySSF466899.38E-2824120IPR009057Homeodomain-like
SMARTSM007172.0E-102575IPR001005SANT/Myb domain
PfamPF002492.0E-132673IPR001005SANT/Myb domain
CDDcd001673.84E-92973No hitNo description
PROSITE profilePS5129425.86974128IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-2677129IPR009057Homeodomain-like
SMARTSM007171.2E-1578126IPR001005SANT/Myb domain
PfamPF002494.1E-1579122IPR001005SANT/Myb domain
CDDcd001672.25E-1181121No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MRKPEPSSAA ASKNNKENNS NSKLRKGLWS PEEDDKLMRY MINNGQGCWS DVARNAGLQR  60
CGKSCRLRWI NYLRPDLKRG AFSPQEEELI IHLHSLLGNR WSQIAAQLPG RTDNEIKNFW  120
NSTIKKRLKN LSSSNGSPNT SDSSPEAKDH RVVAAGRVII PSQEHGMVSI YSDSTPSFMQ  180
SAVLSHMFDP FPVLDIDQGG LTLSGAGGYY NGNPCITQRE IGVGGGGDCY DFGGNGGFGS  240
GDVDIGVEGD IFVPPLESVS IEGQNIKTET TYGDSNNNNN YYNNVHSILT CNKTNKNIKG  300
ESIIGVGNYF DDDQEELTRG DWDLEDLMKD VSSSSFPFLD *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27241285108B-MYB
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744680.0DQ074468.1 Malus x domestica MYB20 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009376885.10.0PREDICTED: transcription factor MYB46-like
TrEMBLQ2LME40.0Q2LME4_MALDO; MYB20
STRINGGLYMA11G14200.21e-115(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77434128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.11e-58myb domain protein 46